engel-patent.compatentanwalt christoph k. engel - patente und marken - engel patentanwaltskanzlei, thüringen

engel-patent.com Profile

engel-patent.com

Title:patentanwalt christoph k. engel - patente und marken - engel patentanwaltskanzlei, thüringen

Description:engel patentanwaltskanzlei Suhl (Thür.)

Keywords: Engel, Engel+Weihrauch, Engel&Weihrauch, Patent, Patentanwalt, Anwaltskanzlei, patentamt, Patentanwalt, Rechtsanwalt, AG, Abmahnung, Anwalt, Beratung, beratung, datenschutz, domainname, Domainrecht...

Discover engel-patent.com website stats, rating, details and status online. Read and write reviews or vote to improve it ranking. Check alliedvsaxis duplicates with related css, domain relations, most used words, social networks references. Find out where is server located. Use our online tools to find owner and admin contact info. Go to regular site

engel-patent.com Information

Website / Domain: engel-patent.com
Website IP Address: 81.169.145.146
Domain DNS Server: shades11.rzone.de,docks18.rzone.de

engel-patent.com Rank

Alexa Rank: 0
OursSite Rank: 0
Google Page Rank: 0/10 (Google Pagerank Has Been Closed)

engel-patent.com Traffic & Earnings

Purchase/Sale Value: $0
Daily Revenue: $0
Monthly Revenue: $0
Yearly Revenue: $0
Daily Unique Visitors: 0
Monthly Unique Visitors: 0
Yearly Unique Visitors: 0

engel-patent.com WebSite Httpheader

StatusCode 200
Content-Type text/html
Date Wed, 26 Jul 2017 12:43:36 GMT
Server Apache/2.2.31 (Unix)

engel-patent.com Keywords accounting

Keyword Count Percentage
Engel 8 1.82%
Engel+Weihrauch 0 0.00%
Engel&Weihrauch 0 0.00%
Patent 15 4.20%
Patentanwalt 7 3.91%
Anwaltskanzlei 4 2.57%
patentamt 1 0.40%
Patentanwalt 7 3.91%
Rechtsanwalt 0 0.00%
AG 4 0.36%
Abmahnung 0 0.00%
Anwalt 7 1.92%
Beratung 0 0.00%
beratung 0 0.00%
datenschutz 0 0.00%
domainname 0 0.00%
Domainrecht... 0 0.00%

engel-patent.com Similar Website

Domain WebSite Title
claddingwarehouse.co.uk Hygienic Wall Cladding | Plastic Cladding | White Wall PVC Cladding | Cladding Warehouse
woodtrend.co.uk Woodtrend
bestknifesharpeningsystemreview.com Best Knife Sharpening System 2016: Reviews, Top Picks
marshillvet.com Mars Hill Animal Hospital - Oconee and Athens Georgia Vet - Mars Hill Animal Hospital
bathroomcladdingdirect.co.uk Bathroom Cladding Direct
angini.it I colori dell'Anima | Vittorio Angini – Pittore
blrvacations.com Western North Carolina Vacation Rentals, Cashiers Region Mountain & Lake Rental Homes
lacalacabali.com Lacalaca - Cantina Mexicana in Seminyak, Bali
kingandfifth.com King and Fifth Supply Co. - Cool Slouchy Beanies, Hats, and Mens Tee's
runnymede.com.au Home - Runnymede
oranparktowncafe.com.au Oran Park Town Cafe
siteflex.com.au Siteflex - Web Content Management, Email Marketing, Ecommerce and CRM made easy
designerwebsites.co.nz Designer Websites | Website Design Auckland | Web Design | Digital Marketing
furniturelab.co.nz Furniture Lab | Auckland’s newest home to furniture solutions
christiandatebook.com Christian Datebook | Online Christian Dating
leduccinemas.com Leduc Cinemas
leducchiropractor.com Leduc Chiropractor, Leduc AB - Baynes Family Chiropractic (780) 986-1837
smoe.com Home

engel-patent.com Traffic Sources Chart

engel-patent.com Alexa Rank History Chart

engel-patent.com aleax

engel-patent.com Html To Plain Text

patentanwalt christoph k. engel - patente und marken - engel patentanwaltskanzlei, thüringen home impressum sitemap english aktuelles leistungen unternehmen kontakt termine ver?ffentlichungen weiterführende links karriere engel patentanwaltskanzlei marktplatz 6 98527 suhl - germany www.engel-patent.com office@engel-patent.com fon: +49 [3681] 7977-0 fax: +49 [3681] 7977-99 christoph k. engel - dipl.-ing. 1, 3, 4 susann reinhardt 2, 5 marco rittermann - dr.-ing. dipl.-ing. 1, 3, 4 1 patentanwalt 2 rechtsanw?ltin 3 european patent attorney 4 europ. trademark + design attorney 5 fachanw?ltin für gewerblichen rechtsschutz engel patentanwaltskanzlei hilft Ihnen bei der Anmeldung von Schutzrechten, insbesondere Patenten, Marken und Designs. Wir arbeiten überwiegend für mittelst?ndische Unternehmen mit Sitz In Deuschland. Dar?ber hinaus sind wir für Patentabteilungen gro?er Industriebetriebe sowie f?r ausl?ndische Unternehmen, beispielsweise aus den USA und Russland, t?tig. engel patentanwaltskanzlei unterstützt Sie auch in schutzrechtsbezogenen streitigen Auseinandersetzungen. Wir vertreten unsere Mandanten in Verfahren vor den Land- und Oberlandesgerichten, dem Bundespatentgericht, dem Bundesgerichtshof, den Beschwerdekammern des Europ?ischen Patentamts, den Beschwerdekammern des Harmonisierungsamtes f?r den Binnenmarkt und dem Europ?ischen Gericht. Unsere Kanzlei besitzt seit 1999 ein zertifiziertes Qualit?tsmanagementsystem, welches regelm??ig auf seine Wirksamkeit überprüft wird. Ein wesentliches Kriterium in unserem Qualit?tsmanagementsystem ist die Zufriedenheit unserer Mandanten. Sie haben die M?glichkeit, unsere Arbeit im Rahmen einer Mandantenbefragung anhand eines Fragebogens zu bewerten. Die Familienfreundlichkeit wird bei uns gro? geschrieben. Auch aus diesem Grund sind wir Mitglied im Netzwerk Erfolgsfaktor Familie des Bundesfamilienministeriums. Zur besseren Vereinbarkeit von Familie und Beruf nutzen wir beispielsweise Telearbeitspl?tze. aktuell: ?Aus GEMEINSCHAFTSMARKE wird UNIONSMARKE [newsletter] ?Auszubildende/r zur/zum Patentanwaltsfachangestellte/n gesucht [karriere] ?Jurist/in gesucht [karriere] [?ltere Meldungen] zurück | nach oben | kontakt | impressum letzte ?nderung: 04.04.2016

engel-patent.com Whois

Domain Name: engel-patent.com Registry Domain ID: 11634615 Registrar Whois Server: whois.cronon.net Registrar URL: http://www.cronon.net Updated Date: 2010-11-29T00:00:00Z Creation Date: 2010-11-29T00:00:00Z Registrar Registration Expiration Date: 2016-10-11T00:00:00Z Registrar: Cronon AG Registrar IANA ID: 141 Registrar Abuse Contact Email: abuseⓜstrato.de Registrar Abuse Contact Phone: +49.303001460 Reseller: Domain Status: ok Registry Registrant ID: Registrant Name: engel patentanwaltskanzlei Registrant Organization: Registrant Street: Christoph K Engel Registrant Street: Marktplatz 6 Registrant City: Suhl Registrant State/Province: Germany Registrant Postal Code: 98527 Registrant Country: DE Registrant Phone: +49.368179770 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: kathrin-heroldⓜweb.de Registry Admin ID: Admin Name: Christoph K Engel Admin Organization: Admin Street: Marktplatz 6 Admin City: Suhl Admin State/Province: Germany Admin Postal Code: 98527 Admin Country: DE Admin Phone: +49.368179770 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: kathrin-heroldⓜweb.de Registry Tech ID: Tech Name: Hostmaster Strato Rechenzentrum Tech Organization: Cronon AG Professional IT-Services Tech Street: Emmy-Noether-Str. 10 Tech City: Karlsruhe Tech State/Province: Tech Postal Code: 76131 Tech Country: DE Tech Phone: +49.72166320305 Tech Phone Ext: Tech Fax: +49.72166320303 Tech Fax Ext: Tech Email: hostmasterⓜcronon-isp.net Name Server: docks18.rzone.de Name Server: shades11.rzone.de DNSSEC: URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2016-05-13T20:47:49Z <<< For more information on Whois status codes, please visit https://www.icann.org/ep